PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G216800.1.p
Common NameLOC101770038, SETIT_002334mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 312aa    MW: 32237.6 Da    PI: 8.0531
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G216800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.2e-14136180347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W++eE+ +++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qk+
  Seita.5G216800.1.p 136 PWSEEEHRQFLAGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKF 180
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.013129185IPR017930Myb domain
SuperFamilySSF466894.64E-17130186IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17132184IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.5E-11133176IPR009057Homeodomain-like
SMARTSM007177.9E-11133183IPR001005SANT/Myb domain
PfamPF002498.9E-11136179IPR001005SANT/Myb domain
CDDcd001679.67E-10136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MARKCSHCGN YGHNSRTCGL GNSRETMLCQ GGGDNGGGVG GGSRSGGGTS GLRLFGVQVH  60
AGGGGAGSAA ASMKKSYSMD CLQLAAPGCS IVSPSSSSSS SLLLSIEEGL ERAAATNGYL  120
SDGNARVVAE RKKGVPWSEE EHRQFLAGLE KLGKGDWRGI SRNYVTTRTP TQVASHAQKF  180
FLRQSSMGKK KRRSSLFDMV PICENSSSIS DPPSSEGAST SLSLNVSRHE QSSERTTAFD  240
LNSTEEDDGR ADVSSASGAG TRPFPAAAAA PPPTELQPPH GHGHGHGHGH HHCSPLELEL  300
GMSLSTPFIG T*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188192KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794481e-165HF679448.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB42 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969089.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLK3XKB10.0K3XKB1_SETIT; Uncharacterized protein
STRINGSi002334m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-49MYB_related family protein